PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_17842_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 358aa    MW: 40311.2 Da    PI: 5.9558
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_17842_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.32.4e-15248348
                                          SS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding  3 rWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                                          +W++eEd +l++++++ G+g +W + ++++g++R++k+c++rw++yl
  cra_locus_17842_iso_1_len_1170_ver_3  2 PWSPEEDAKLKEYIEKNGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 48
                                          8********************************************97 PP

2Myb_DNA-binding38.92e-125597246
                                          SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                       Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                                          g +T+eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
  cra_locus_17842_iso_1_len_1170_ver_3 55 GGFTEEEDNIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 97
                                          569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007174.5E-8150IPR001005SANT/Myb domain
PROSITE profilePS5129413.723148IPR017930Myb domain
PfamPF002491.4E-14248IPR001005SANT/Myb domain
CDDcd001673.82E-9248No hitNo description
Gene3DG3DSA:1.10.10.603.5E-24255IPR009057Homeodomain-like
SuperFamilySSF466893.09E-25295IPR009057Homeodomain-like
PROSITE profilePS5129422.10949103IPR017930Myb domain
SMARTSM007172.3E-1153101IPR001005SANT/Myb domain
PfamPF002495.9E-115597IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2356103IPR009057Homeodomain-like
CDDcd001674.72E-85799No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0035987Biological Processendodermal cell differentiation
GO:0045597Biological Processpositive regulation of cell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000021Biological Processregulation of ion homeostasis
GO:2000067Biological Processregulation of root morphogenesis
GO:0048226Cellular ComponentCasparian strip
GO:0000975Molecular Functionregulatory region DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
XPWSPEEDAK LKEYIEKNGT GGNWIALPQK IGLKRCGKSC RLRWLNYLRP NIKHGGFTEE  60
EDNIICSLYI SIGSRWSIIA AQLPGRTDND IKNYWNTRLK KKLLGRRKQS NRLSSSVHDH  120
HQKDINIIGN NTEENPHSLS NLSNSALERL QLHMQLQNPF SNFYNNHPSL WPKLNPLQIQ  180
NVPLIQEISP PSTTQLGLGQ NHLGFLHAQQ ECSKIPPPGR RNDDDLEELS NNMMAAAATK  240
SSSNVSELLL LQESSSSGGG INNINQPNIS TLITQAEIDN FLNMTKSGDF EIINDDDDAS  300
RDNNNLIMWW SNENIDTNSA SSNSWESNSL LHHQSDQGIF GQDYSVLGYS TNLXFGEN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-2321039108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006453430.11e-108hypothetical protein CICLE_v10010364mg
RefseqXP_006474624.11e-108PREDICTED: transcription factor RAX3
TrEMBLA0A068U3621e-109A0A068U362_COFCA; Uncharacterized protein
STRINGPOPTR_0018s10390.11e-95(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154